Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial, Biotinylated (Active)

Product Overview

• Article Name: Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial, Biotinylated (Active)
• Biozol Catalog Number: CSB-MP866317HU-B
• Supplier Catalog Number: CSB-MP866317HU-B
• Alternative Catalog Number: CSB-MP866317HU-B-1, CSB-MP866317HU-B-100, CSB-MP866317HU-B-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: /

Product Properties

• Molecular Weight: 112.6 kDa
• Tag: C-terminal mFc-Avi-tagged
• UniProt: Q9BYF1
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Mammalian cell
• Expression System: 18-740
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG

Images

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD(CSB-MP3324GMY1b1)at 2 µg/ml can bind Biotinylated human ACE2, the EC50 is 4.599-8.322 ng/ml.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.