Recombinant Human UL16-binding protein 1 (ULBP1), Biotinylated (Active)

Product Overview

• Article Name: Recombinant Human UL16-binding protein 1 (ULBP1), Biotinylated (Active)
• Biozol Catalog Number: CSB-MP887177HUJ1-B
• Supplier Catalog Number: CSB-MP887177HUj1-B
• Alternative Catalog Number: CSB-MP887177HUJ1-B-1, CSB-MP887177HUJ1-B-100, CSB-MP887177HUJ1-B-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide

Product Properties

• Molecular Weight: 51.3 kDa
• Tag: C-terminal mFc-Avi-tagged
• UniProt: Q9BZM6
• Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Source: Mammalian cell
• Expression System: 26-216aa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Images

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 µg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.