N-terminal 6xHis-NEXT-SUMO-tagged

Catalog Number: CSB-RP623244BA
Article Name: N-terminal 6xHis-NEXT-SUMO-tagged
Biozol Catalog Number: CSB-RP623244BA
Supplier Catalog Number: CSB-RP623244Ba
Alternative Catalog Number: CSB-RP623244BA-1
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 18.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.220.
Source: E.coli
Expression System: 1-169aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAVQHSNAPLIDLGAEMKKQHKEAAPEGAAPAQGKAPAAEAKKEEAPKPKPVVGGGGSGGGGSHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGS