Recombinant Mouse Adenine phosphoribosyltransferase (Aprt)

Catalog Number: CSB-YP001954MO
Article Name: Recombinant Mouse Adenine phosphoribosyltransferase (Aprt)
Biozol Catalog Number: CSB-YP001954MO
Supplier Catalog Number: CSB-YP001954MO
Alternative Catalog Number: CSB-YP001954MO-1, CSB-YP001954MO-100, CSB-YP001954MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: APRT
Molecular Weight: 32.8 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P08030
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-180aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRLLASHLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLEYGKAELEIQKDALEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLVELTSLKGRERLGPIPFFSLLQYD
Application Notes: Research Areas: Others. Endotoxin: Not test