Recombinant Human Arginase-1(ARG1)
Catalog Number:
CSB-YP002005HU
- Images (0)
| Article Name: | Recombinant Human Arginase-1(ARG1) |
| Biozol Catalog Number: | CSB-YP002005HU |
| Supplier Catalog Number: | CSB-YP002005HU |
| Alternative Catalog Number: | CSB-YP002005HU-1,CSB-YP002005HU-100,CSB-YP002005HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Liver-type arginase,Type I arginase |
| Molecular Weight: | 36.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P05089 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-322aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYR |
Product Guarantee and Expert Support
