Recombinant Cat Beta-2-microglobulin (B2M)

Catalog Number: CSB-YP002486CA
Article Name: Recombinant Cat Beta-2-microglobulin (B2M)
Biozol Catalog Number: CSB-YP002486CA
Supplier Catalog Number: CSB-YP002486CA
Alternative Catalog Number: CSB-YP002486CA-1, CSB-YP002486CA-100, CSB-YP002486CA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: B2M
Molecular Weight: 12.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q5MGS7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 21-118aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM
Application Notes: Research Areas: Others. Endotoxin: Not test