Recombinant Rat Tonin (Klk2)

Catalog Number: CSB-YP012453RA
Article Name: Recombinant Rat Tonin (Klk2)
Biozol Catalog Number: CSB-YP012453RA
Supplier Catalog Number: CSB-YP012453RA
Alternative Catalog Number: CSB-YP012453RA-1, CSB-YP012453RA-100, CSB-YP012453RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Esterase 1,Glandular kallikrein-2,RSKG-5,S2 kallikrein
Molecular Weight: 26.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P00759
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.264.
Source: Yeast
Expression System: 25-259aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIETYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKENP
Application Notes: Research Areas: Cancer