Recombinant Trichoderma reesei Hydrophobin-2 (hfb2)

Catalog Number: CSB-YP304437HYEA4
Article Name: Recombinant Trichoderma reesei Hydrophobin-2 (hfb2)
Biozol Catalog Number: CSB-YP304437HYEA4
Supplier Catalog Number: CSB-YP304437HYEa4
Alternative Catalog Number: CSB-YP304437HYEA4-1, CSB-YP304437HYEA4-100, CSB-YP304437HYEA4-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Hydrophobin II
Molecular Weight: 23.2 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P79073
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 16-86aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF