Recombinant Viscum album Beta-galactoside-specific lectin 1, partial

Catalog Number: CSB-YP305846VDO
Article Name: Recombinant Viscum album Beta-galactoside-specific lectin 1, partial
Biozol Catalog Number: CSB-YP305846VDO
Supplier Catalog Number: CSB-YP305846VDO
Alternative Catalog Number: CSB-YP305846VDO-1, CSB-YP305846VDO-100, CSB-YP305846VDO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-galactoside-specific lectin I Viscumin
Molecular Weight: 30.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P81446
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 34-287aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS