Recombinant Vibrio cholerae serotype O1 Sialidase (nanH), partial

Catalog Number: CSB-YP314042VEX
Article Name: Recombinant Vibrio cholerae serotype O1 Sialidase (nanH), partial
Biozol Catalog Number: CSB-YP314042VEX
Supplier Catalog Number: CSB-YP314042VEX
Alternative Catalog Number: CSB-YP314042VEX-1, CSB-YP314042VEX-100, CSB-YP314042VEX-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Neuraminidase
Molecular Weight: 33.9 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P0C6E9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 25-216aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ALFDYNATGDTEFDSPAKQGWMQDNTNNGSGVLTNADGMPAWLVQGIGGRAQWTYSLSTNQHAQASSFGWRMTTEMKVLSGGMITNYYANGTQRVLPIISLDSSGNLVVEFEGQTGRTVLATGTAATEYHKFELVFLPGSNPSASFYFDGKLIRDNIQPTASKQNMIVWGNGSSNTDGVAAYRDIKFEIQGD
Application Notes: Research Areas: Others