Recombinant Horse Myelin P2 protein (PMP2)

Catalog Number: CSB-YP315130HO
Article Name: Recombinant Horse Myelin P2 protein (PMP2)
Biozol Catalog Number: CSB-YP315130HO
Supplier Catalog Number: CSB-YP315130HO
Alternative Catalog Number: CSB-YP315130HO-1, CSB-YP315130HO-100, CSB-YP315130HO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: PMP2
Molecular Weight: 15.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P0C6G6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-132aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV
Application Notes: Research Areas: Others. Endotoxin: Not test