Recombinant Chicken Ovoinhibitor (OIH), partial

Catalog Number: CSB-YP318020CH
Article Name: Recombinant Chicken Ovoinhibitor (OIH), partial
Biozol Catalog Number: CSB-YP318020CH
Supplier Catalog Number: CSB-YP318020CH
Alternative Catalog Number: CSB-YP318020CH-1, CSB-YP318020CH-100, CSB-YP318020CH-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: OIH, Ovoinhibitor
Molecular Weight: 51.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P10184
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 26-472aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VNCSLYASGIGKDGTSWVACPRNLKPVCGTDGSTYSNECGICLYNREHGANVEKEYDGECRPKHVMIDCSPYLQVVRDGNTMVACPRILKPVCGSDSFTYDNECGICAYNAEHHTNISKLHDGECKLEIGSVDCSKYPSTVSKDGRTLVACPRILSPVCGTDGFTYDNECGICAHNAEQRTHVSKKHDGKCRQEIPEIDCDQYPTRKTTGGKLLVRCPRILLPVCGTDGFTYDNECGICAHNAQHGTEVKKSHDG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.