Recombinant Emericella nidulans Rodlet protein (rodA)

Catalog Number: CSB-YP326791EKF
Article Name: Recombinant Emericella nidulans Rodlet protein (rodA)
Biozol Catalog Number: CSB-YP326791EKF
Supplier Catalog Number: CSB-YP326791EKF
Alternative Catalog Number: CSB-YP326791EKF-1, CSB-YP326791EKF-100, CSB-YP326791EKF-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Rodlet protein A
Molecular Weight: 24.7 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: P28346
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 42-157aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FPVPENVTVKQASDKCGDQAQLSCCNKATYAGDTTTVDEGLLSGALSGLIGAGSGAEGLGLFDQCSKLDVAVLIGIQDLVNQKCKQNIACCQNSPSSADGNLIGVGLPCVALGSIL
Application Notes: Research Areas: Others