Recombinant Enterobacter aerogenes Outer membrane protein A (ompA), partial

Catalog Number: CSB-YP362604EKN
Article Name: Recombinant Enterobacter aerogenes Outer membrane protein A (ompA), partial
Biozol Catalog Number: CSB-YP362604EKN
Supplier Catalog Number: CSB-YP362604EKN
Alternative Catalog Number: CSB-YP362604EKN-1, CSB-YP362604EKN-100, CSB-YP362604EKN-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Outer membrane porin A
Molecular Weight: 19.3 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P09146
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 195-350aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FGQEDNAPVVAPAPAPAPEVTTKTFTLKSDVLFNFNKATLKPEGQQALDQLYTQLSNMDPKDGSAVVLGYTDRIGSEQYNQKLSEKRAQSVVDYLVAKGIPANKISARGMGESDPVTGNTCDNVKARAALIDCLAPDRRVAIEVKGYKDVVTQPQA
Application Notes: Research Areas: Others. Endotoxin: Not test