Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)

Catalog Number: CSB-YP404273MON
Article Name: Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)
Biozol Catalog Number: CSB-YP404273MON
Supplier Catalog Number: CSB-YP404273MON
Alternative Catalog Number: CSB-YP404273MON-1, CSB-YP404273MON-100, CSB-YP404273MON-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 10 kDa chaperonin,Chaperonin-10
Molecular Weight: 12.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: A5U893
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-100aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
Application Notes: Research Areas: Others