Recombinant Rotavirus X Outer capsid protein VP4, partial

Catalog Number: CSB-YP434929RIR
Article Name: Recombinant Rotavirus X Outer capsid protein VP4, partial
Biozol Catalog Number: CSB-YP434929RIR
Supplier Catalog Number: CSB-YP434929RIR
Alternative Catalog Number: CSB-YP434929RIR-1, CSB-YP434929RIR-100, CSB-YP434929RIR-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Hemagglutinin
Molecular Weight: 30.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: A9Q1L0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-249aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR