Recombinant Human Small proline-rich protein 5 (SPRR5) Preis auf Anfrage

Product Overview

• Article Name: Recombinant Human Small proline-rich protein 5 (SPRR5) Preis auf Anfrage
• Biozol Catalog Number: CSB-YP437181HU
• Supplier Catalog Number: CSB-YP437181HU
• Alternative Catalog Number: CSB-YP437181HU-20, CSB-YP437181HU-100, CSB-YP437181HU-1
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: Small proline-rich protein 5 SPRR5

Product Properties

• Molecular Weight: /
• Tag: Tag type will be determined during the manufacturing process. (Note:If you have specified tag type, please tell us or remark on your PO and we will develop the specified tag preferentially.)
• UniProt: A0A1B0GTR4
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: Full Length
• Target: MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.