Recombinant Salmonella heidelberg D-serine dehydratase (dsdA)

Catalog Number: CSB-YP472744SWQ
Article Name: Recombinant Salmonella heidelberg D-serine dehydratase (dsdA)
Biozol Catalog Number: CSB-YP472744SWQ
Supplier Catalog Number: CSB-YP472744SWQ
Alternative Catalog Number: CSB-YP472744SWQ-1, CSB-YP472744SWQ-100, CSB-YP472744SWQ-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: D-serine deaminase
Molecular Weight: 49.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: B4TA53
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-440aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MENIQKLIARYPLVEDLVALKETTWFNPGATSLAQGLPYVGLTEQDVNAAHDRLARFAPYLAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTIDGEMLLKKDSHLAISGSIKARGGIYEVLTHAEKLALEAGLLTTDDDYSVLLSPEFKQFFSQYSIAVGSTGNLGLSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPNCFFIDDENSRTLFLGYAVAGQRLKA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.