Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Catalog Number: CSB-YP843142HUA4
Article Name: Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)
Biozol Catalog Number: CSB-YP843142HUA4
Supplier Catalog Number: CSB-YP843142HUa4
Alternative Catalog Number: CSB-YP843142HUA4-1, CSB-YP843142HUA4-100, CSB-YP843142HUA4-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Putative HeLa tumor suppressor
Molecular Weight: 23.6 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: Q8N2G4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 21-117aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS
Application Notes: Research Areas: Cancer