Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial

Catalog Number: CSB-YP849611PPW
Article Name: Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial
Biozol Catalog Number: CSB-YP849611PPW
Supplier Catalog Number: CSB-YP849611PPW
Alternative Catalog Number: CSB-YP849611PPW-1, CSB-YP849611PPW-100, CSB-YP849611PPW-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: E2,Peplomer protein
Molecular Weight: 30.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q91AV1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 19-278aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPQDVTRCQSTTNFRRFFSKFNVQAPAVVVLGGYLPSMNSSSWYCGTGIETASGVHGIFLSYIDSGQGFEIGISQEPFDPSGYQLYLHKATNGNTNAIARLRICQFPDNKTLGPTVNDVTTGRNCLFNKAIPAYMRDGKDIVVGITWDNDRVTVFADKIYHFYLKNDWSRVATRCYNRRSCAMQYVYTPTYYMLNVTSAGEDGIYYEPCTANCTGYAANVFATDSNGHIPEGFSFNNWFLLSNDSTLLHGKVVSN
Application Notes: Research Areas: Others