Recombinant Mouse Transmembrane protease serine 2 (Tmprss2), partial

Catalog Number: CSB-YP884918MO
Article Name: Recombinant Mouse Transmembrane protease serine 2 (Tmprss2), partial
Biozol Catalog Number: CSB-YP884918MO
Supplier Catalog Number: CSB-YP884918MO
Alternative Catalog Number: CSB-YP884918MO-1, CSB-YP884918MO-100, CSB-YP884918MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Epitheliasin)(Plasmic transmembrane protein X)
Molecular Weight: 44.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9JIQ8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 105-490aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLV