Urodilatin

Catalog Number: ECH-151-30
Article Name: Urodilatin
Biozol Catalog Number: ECH-151-30
Supplier Catalog Number: 151-30
Alternative Catalog Number: ECH-151-30-0.5MG, ECH-151-30-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 115966-23-9 Molecular Weight: 3505.7 Salt Form: TFA Purity: >96% Sequence (3-letter): Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH Sequence (1-letter): TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH Storage: -20 ?C or below Urodilatin is a cardiovascular hormone which causes sodium excretion in urine (natriuresis) by increasing renal blood flow. It is secreted in the kidney in response to increasing mean arterial pressure.
Application Notes: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature