Brain Natriuretic Peptide (BNP) (1-32), human / Brain ANP (1-32), human

Catalog Number: ECH-152-52
Article Name: Brain Natriuretic Peptide (BNP) (1-32), human / Brain ANP (1-32), human
Biozol Catalog Number: ECH-152-52
Supplier Catalog Number: 152-52
Alternative Catalog Number: ECH-152-52-0.5MG, ECH-152-52-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 124584-08-3 Molecular Weight: 3463.76 Salt Form: TFA Purity: >90% Sequence (3-letter): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26] Sequence (1-letter): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH Storage: -20 ?C or below Brain Natriuretic Peptide (BNP) (1-32) is a bioactive fragment of the 108-aa inactive precursor pro-BNP. Like all natriuretic peptides, BNP (1-32) has an important role in cardiac homeostasis. It binds to the NPR-A receptor and its actions include vasodilation and inhibition of the renal-angiotensin-aldosterone sysntem (RAAS).
Application Notes: Categories: Peptides. Related: Cardiovascular, Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature