Brain Natriuretic Peptide (BNP) (1-32) human / Brain ANP (1-32) human, CAS [[124584-08-3]]

Product Overview

• Article Name: Brain Natriuretic Peptide (BNP) (1-32) human / Brain ANP (1-32) human, CAS [[124584-08-3]]
• Biozol Catalog Number: ECH-152-52-1MG
• Supplier Catalog Number: 152-52-1mg
• Alternative Catalog Number: ECH-152-52-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 124584-08-3Molecular Weight: 3464.10Salt Form: TFAPurity: >90%Sequence (3-letter): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26]Sequence (1-letter): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OHStorage: -20 AC or belowBrain Natriuretic Peptide (BNP) (1-32) is a bioactive fragment of the 108-aa inactive precursor pro-BNP. Like all natriuretic peptides BNP (1-32) has an important role in cardiac homeostasis. It binds to the NPR-A receptor and its actions include vasodilation and inhibition of the renal-angiotensin-aldosterone sysntem (RAAS).

Product Properties

• Tag: 1180 1178
• CAS Number: [124584-08-3]