Calcitonin Gene Related Peptide II (8-37) human / Beta CGRP, CAS [[119911-68-1]]

Product Overview

• Article Name: Calcitonin Gene Related Peptide II (8-37) human / Beta CGRP, CAS [[119911-68-1]]
• Biozol Catalog Number: ECH-231-22-0.5MG
• Supplier Catalog Number: 231-22-0.5mg
• Alternative Catalog Number: ECH-231-22-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 119911-68-1Molecular Weight: 3130.68Salt Form: TFAPurity: >95%Sequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2Sequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2Storage: -20 AC or belowCalcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors.Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system appetite suppression gastric acid release temperature homeostasis and heart rate. CGRP exists in two forms CGRP I (CGRP-i) and CGRP II (CGRP-i)

Product Properties

• Tag: 1185
• CAS Number: [119911-68-1]