Calcitonin Gene Related Peptide II (8-37) human / Beta CGRP, CAS [[119911-68-1]]

Catalog Number: ECH-231-22-1MG
Article Name: Calcitonin Gene Related Peptide II (8-37) human / Beta CGRP, CAS [[119911-68-1]]
Biozol Catalog Number: ECH-231-22-1MG
Supplier Catalog Number: 231-22-1mg
Alternative Catalog Number: ECH-231-22-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 119911-68-1Molecular Weight: 3130.68Salt Form: TFAPurity: >95%Sequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2Sequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2Storage: -20 AC or belowCalcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors.Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system appetite suppression gastric acid release temperature homeostasis and heart rate. CGRP exists in two forms CGRP I (CGRP-i) and CGRP II (CGRP-i)
Tag: 1185
CAS Number: [119911-68-1]