Calcitonin human cyclic, CAS [[21215-62-3]]

Catalog Number: ECH-231-25-5MG
Article Name: Calcitonin human cyclic, CAS [[21215-62-3]]
Biozol Catalog Number: ECH-231-25-5MG
Supplier Catalog Number: 231-25-5mg
Alternative Catalog Number: ECH-231-25-5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 21215-62-3Molecular Weight: 3417.6Salt Form: TFAPurity: >96%Sequence (3-letter): Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 [Cys1-Cys7]Sequence (1-letter): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2Storage: -20 AC or belowCalcitonin is a peptide hormone which reduces levels of blood calcium (Ca2+) in opposition of the parathyroid hormone (PTH). It is formed by the proteolytic cleavage of a larger prepropeptide and is excreted by parafollicular cells of the thyroid gland. It is not a significant factor in humans for calcium homeostasis unlike other animals.
Tag: 1185
CAS Number: [21215-62-3]