Parathyroid Hormone (PTH) (3-34) human

Catalog Number: ECH-231-46-0.5MG
Article Name: Parathyroid Hormone (PTH) (3-34) human
Biozol Catalog Number: ECH-231-46-0.5MG
Supplier Catalog Number: 231-46-0.5mg
Alternative Catalog Number: ECH-231-46-0.5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 3929.06Salt Form: TFAPurity: >96%Sequence (3-letter): Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHSequence (1-letter): SEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OHStorage: -20 AC or belowParathyroid Hormone (PTH) regulates serum calcium levels through its effects in the kidney intestines and bones. When serum calcium levels are low PTH is secreted by the chief cells of the parathyroid gland stimulating osteoclast activity and bone resorption thus the release of calcium. Measuring serum or plasma PTH levels is important for patients in chronic renal failure. Synthetic N-terminal truncated PTH peptides [e.g. PTH(2a€''34) PTH(3a€''34) and PTH(7a€''84)] do not crossa€react with the detection antibodies used in seconda€generation PTH assays.
Tag: 1178