Parathyroid Hormone (PTH) (4-34) human

Catalog Number: ECH-231-48-1MG
Article Name: Parathyroid Hormone (PTH) (4-34) human
Biozol Catalog Number: ECH-231-48-1MG
Supplier Catalog Number: 231-48-1mg
Alternative Catalog Number: ECH-231-48-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 3842.03Salt Form: TFAPurity: >96%Sequence (3-letter): Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OHSequence (1-letter): EIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OHStorage: -20 AC or belowParathyroid Hormone (4-34) is a N-terminal truncated form of the full length Parathyroid Hormone (PTH). PTH regulates serum calcium levels through its effects in the kidney intestines and bones. When serum calcium levels are low PTH is secreted by the chief cells of the parathyroid gland stimulating osteoclast activity and bone resorption thus the release of calcium.
Tag: 1178