Parathyroid Hormone (PTH) (5-34), human

Catalog Number: ECH-231-51
Article Name: Parathyroid Hormone (PTH) (5-34), human
Biozol Catalog Number: ECH-231-51
Supplier Catalog Number: 231-51
Alternative Catalog Number: ECH-231-51-0.5MG, ECH-231-51-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 3712.99 Salt Form: TFA Purity: >96% Sequence (3-letter): Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH Sequence (1-letter): IQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH Storage: -20 ?C or below Parathyroid Hormone (5-34) is a N-terminal truncated form of the full length Parathyroid Hormone (PTH). PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium.
Application Notes: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature