Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin)

Catalog Number: ECH-274-56
Article Name: Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin)
Biozol Catalog Number: ECH-274-56
Supplier Catalog Number: 274-56
Alternative Catalog Number: ECH-274-56-0.5MG, ECH-274-56-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 3525.73 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH Sequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OH Storage: -20 ?C or below Leumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective ?-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form.
Application Notes: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature