Beta Endorphin, human / Beta Lipotropin (61-91), human
Biozol Catalog Number:
ECH-291-25
Supplier Catalog Number:
291-25
Alternative Catalog Number:
ECH-291-25-1MG, ECH-291-25-5MG
Manufacturer:
Echelon Biosciences
Category:
Molekularbiologie
CAS Number: 61214-51-5 Molecular Weight: 3462.82 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH Sequence (1-letter): YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH Storage: -20 ?C or below Beta Endorphin is an endogenous neuropeptide which acts as an agonist for opioid receptors. It binds strongly to ? receptors in brain and by ? and ? receptors in the spinal cord. Beta Endorphin is released in response to painful stimuli and is studied for its effects on pain perception (nociception). It is found in the hypothalmus and pituitary gland and is formed by cleavage of the C-terminal region of ?-lipotropin.