Big Endothelin (1-38) human, CAS [[121014-53-7]]

Product Overview

• Article Name: Big Endothelin (1-38) human, CAS [[121014-53-7]]
• Biozol Catalog Number: ECH-331-30-0.5MG
• Supplier Catalog Number: 331-30-0.5mg
• Alternative Catalog Number: ECH-331-30-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 121014-53-7Molecular Weight: 4283.98Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OHStorage: -20 AC or belowBig Endothelin (1-38) is the precursor to the vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

Product Properties

• Tag: 1180 1178
• CAS Number: [121014-53-7]