Adrenomedullin (22-52) human, CAS [[159899-65-7]]

Product Overview

• Article Name: Adrenomedullin (22-52) human, CAS [[159899-65-7]]
• Biozol Catalog Number: ECH-331-82-1MG
• Supplier Catalog Number: 331-82-1mg
• Alternative Catalog Number: ECH-331-82-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 159899-65-7Molecular Weight: 3573.88Salt Form: TFAPurity: >96%Sequence (3-letter): Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2Sequence (1-letter): TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2Storage: -20 AC or belowAdrenomedullin (22-52) is an andrenomedullin (ADM) antagonist which blocks production of cAMP. In addition it antagonizes the calcitonin generelated peptide (CGRP) receptor.

Product Properties

• Tag: 1178
• CAS Number: [159899-65-7]