Big Endothelin 1 (1-39) porcine, CAS [[120796-99-8]]

Product Overview

• Article Name: Big Endothelin 1 (1-39) porcine, CAS [[120796-99-8]]
• Biozol Catalog Number: ECH-334-10-0.5MG
• Supplier Catalog Number: 334-10-0.5mg
• Alternative Catalog Number: ECH-334-10-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 120796-99-8Molecular Weight: 4385.03Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS-OHStorage: -20 AC or belowBig Endothelin (1-39) is the precursor to the porcine vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).

Product Properties

• Tag: 1178
• CAS Number: [120796-99-8]