Adrenomedullin (1-50) rat, CAS [[159964-38-2]]

Product Overview

• Article Name: Adrenomedullin (1-50) rat, CAS [[159964-38-2]]
• Biozol Catalog Number: ECH-335-75-0.5MG
• Supplier Catalog Number: 335-75-0.5mg
• Alternative Catalog Number: ECH-335-75-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 159964-38-2Molecular Weight: 5727.72Salt Form: TFAPurity: >96%Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys14-Cys19]Sequence (1-letter): YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2Storage: -20 AC or belowAdrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma a tumor of the adrenal medulla. ADM has roles in tumor progression regulating endometrial angiogenesis hypertension and cardiovascualar disease.

Product Properties

• Tag: 1180 1178
• CAS Number: [159964-38-2]