Adrenomedullin (11-50), rat

Catalog Number: ECH-335-80
Article Name: Adrenomedullin (11-50), rat
Biozol Catalog Number: ECH-335-80
Supplier Catalog Number: 335-80
Alternative Catalog Number: ECH-335-80-0.5MG, ECH-335-80-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 163648-32-6 Molecular Weight: 4520.17 Salt Form: TFA Purity: >96% Sequence (3-letter): Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 Sequence (1-letter): STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 Storage: -20 ?C or below Adrenomedullin (11-50) in the active C-terminal fragment of rat adrenomedullin. Adrenomedullin is thought to be a vasodilator and is found in high concentrations in the blood. It also stimulates angiogenesis and increases cellular tolerance to hypoxic injury and oxidative stress.
Application Notes: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature