Corticotropin Releasing Factor (CRF) human, rat

Catalog Number: ECH-351-25
Article Name: Corticotropin Releasing Factor (CRF) human, rat
Biozol Catalog Number: ECH-351-25
Supplier Catalog Number: 351-25
Alternative Catalog Number: ECH-351-25-0.5MG, ECH-351-25-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 86784-80-7 Molecular Weight: 4754.52 Salt Form: TFA Purity: >95% Sequence (3-letter): Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 Sequence (1-letter): SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 Storage: -20 ?C or below Corticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis.
Application Notes: Categories: Peptides. Related: Neuropeptides & Hormones. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature