Corticotropin Releasing Factor (CRF) human rat, CAS [[86784-80-7]]

Product Overview

• Article Name: Corticotropin Releasing Factor (CRF) human rat, CAS [[86784-80-7]]
• Biozol Catalog Number: ECH-351-25-0.5MG
• Supplier Catalog Number: 351-25-0.5mg
• Alternative Catalog Number: ECH-351-25-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 86784-80-7Molecular Weight: 4757.52Salt Form: TFAPurity: >95%Sequence (3-letter): Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2Sequence (1-letter): SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2Storage: -20 AC or belowCorticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH as part of the HPA Axis.

Product Properties

• Tag: 1433 1335 1431 1432 1178
• CAS Number: [86784-80-7]