Corticotropin Releasing Factor (CRF) ovine, CAS [[79804-71-0]]

Product Overview

• Article Name: Corticotropin Releasing Factor (CRF) ovine, CAS [[79804-71-0]]
• Biozol Catalog Number: ECH-352-26-1MG
• Supplier Catalog Number: 352-26-1mg
• Alternative Catalog Number: ECH-352-26-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 79804-71-0Molecular Weight: 4667.51Salt Form: TFAPurity: >95%Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2Storage: -20 AC or belowCorticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH as part of the HPA Axis.

Product Properties

• Tag: 1178
• CAS Number: [79804-71-0]