Corticotropin Releasing Factor (CRF) [Tyr0] ovine

Catalog Number: ECH-352-37-1MG
Article Name: Corticotropin Releasing Factor (CRF) [Tyr0] ovine
Biozol Catalog Number: ECH-352-37-1MG
Supplier Catalog Number: 352-37-1mg
Alternative Catalog Number: ECH-352-37-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 4830.57Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2Sequence (1-letter): YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2Storage: -20 AC or belowCorticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH as part of the HPA Axis. CRF [Tyr0] has an N-terminal Tyr added which can be radiolabeled with I-125.
Tag: 1178