Corticotropin Releasing Factor (CRF) bovine, CAS [[92307-52-3]]

Product Overview

• Article Name: Corticotropin Releasing Factor (CRF) bovine, CAS [[92307-52-3]]
• Biozol Catalog Number: ECH-353-26-0.5MG
• Supplier Catalog Number: 353-26-0.5mg
• Alternative Catalog Number: ECH-353-26-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 92307-52-3Molecular Weight: 4697.34Salt Form: TFAPurity: >95%Sequence (3-letter): Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2Sequence (1-letter): SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2Storage: -20 AC or belowCorticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH as part of the HPA Axis.

Product Properties

• Tag: 1192
• CAS Number: [92307-52-3]