Galanin Message Associated Peptide (GMAP) (1-41) amide, CAS [[132699-74-2]]

Product Overview

• Article Name: Galanin Message Associated Peptide (GMAP) (1-41) amide, CAS [[132699-74-2]]
• Biozol Catalog Number: ECH-421-35-0.5MG
• Supplier Catalog Number: 421-35-0.5mg
• Alternative Catalog Number: ECH-421-35-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 132699-74-2Molecular Weight: 4640.38Salt Form: TFAPurity: >95%Sequence (3-letter): Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2Sequence (1-letter): ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2Storage: -20 AC or belowGalanin Message Associated Peptide (GMAP) is part of the pre-progalanin Galanin (ppGAL) molecule which is a precursor to the neuropeptide galanin. No physiological role for GMAP was known but recent research suggest it has a role in the innate immune system.

Product Properties

• Tag: 1178
• CAS Number: [132699-74-2]