Charybdotoxin, CAS [[95751-30-7]]

Product Overview

• Article Name: Charybdotoxin, CAS [[95751-30-7]]
• Biozol Catalog Number: ECH-429-60-1MG
• Supplier Catalog Number: 429-60-1mg
• Alternative Catalog Number: ECH-429-60-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 95751-30-7Molecular Weight: 4298.92Salt Form: TFAPurity: >95%Sequence (3-letter): Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH [Cys7-Cys28 Cys13-Cys33 Cys17-35]Sequence (1-letter): (Glp)FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OHStorage: -20 AC or belowCharybdotoxin is a potent neurotoxin isolated from the deathstalker scorpion Leiurus quinquestriatus hebraeus. Charybdotoxin depolarizes peripheral T lymphocytes by binding to Ca2+-activated K+ channels and blocks their mitogen-induced proliferation.

Product Properties

• Tag: 1192
• CAS Number: [95751-30-7]