Teduglutide / GLP 2 [Gly2] human, CAS [[197922-42-2]]

Catalog Number: ECH-471-21-0.5MG
Article Name: Teduglutide / GLP 2 [Gly2] human, CAS [[197922-42-2]]
Biozol Catalog Number: ECH-471-21-0.5MG
Supplier Catalog Number: 471-21-0.5mg
Alternative Catalog Number: ECH-471-21-0.5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 197922-42-2 Molecular Weight: 3749.81 Salt Form: TFA Purity: >95% Sequence (3-letter): His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH Sequence (1-letter): HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-OH Storage: -20 AC or belowTeduglutide is an analog of glucagon-like peptide-2 (GLP-2) in which the Ala at position 2 has been replaced by Gly. It is prescribed under the trade name Gattex to treat short-bowel syndrome.
Tag: 1191 1178
CAS Number: [197922-42-2]