Teduglutide / GLP 2 [Gly2] human, CAS [[197922-42-2]]

Product Overview

• Article Name: Teduglutide / GLP 2 [Gly2] human, CAS [[197922-42-2]]
• Biozol Catalog Number: ECH-471-21-1MG
• Supplier Catalog Number: 471-21-1mg
• Alternative Catalog Number: ECH-471-21-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 197922-42-2 Molecular Weight: 3749.81 Salt Form: TFA Purity: >95% Sequence (3-letter): His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH Sequence (1-letter): HGDGSFSDEMNTILDNLAARDFINWLIQTKITD-OH Storage: -20 AC or belowTeduglutide is an analog of glucagon-like peptide-2 (GLP-2) in which the Ala at position 2 has been replaced by Gly. It is prescribed under the trade name Gattex to treat short-bowel syndrome.

Product Properties

• Tag: 1191 1178
• CAS Number: [197922-42-2]