Galanin human, CAS [[119418-04-1]]

Product Overview

• Article Name: Galanin human, CAS [[119418-04-1]]
• Biozol Catalog Number: ECH-471-22-1MG
• Supplier Catalog Number: 471-22-1mg
• Alternative Catalog Number: ECH-471-22-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 119418-04-1Molecular Weight: 3155.57Salt Form: TFAPurity: >96%Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OHSequence (1-letter): GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-OHStorage: -20 AC or belowGalanin is an endogenous peptide that has been shown to have an action on intestinal smooth muscle insulin and somatostatin release and synaptic neurotransmission.

Product Properties

• Tag: 1196 1178
• CAS Number: [119418-04-1]