Glucagon-like Peptide-1 (GLP-1) (7-36) / Preproglucagon (78-107) amide, CAS [[107444-51-9]]

Product Overview

• Article Name: Glucagon-like Peptide-1 (GLP-1) (7-36) / Preproglucagon (78-107) amide, CAS [[107444-51-9]]
• Biozol Catalog Number: ECH-471-28-0.5MG
• Supplier Catalog Number: 471-28-0.5mg
• Alternative Catalog Number: ECH-471-28-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 107444-51-9Molecular Weight: 3297.69Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2Sequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Storage: -20 AC or belowGlucagon-like Peptide-1 (7-36) is one the two primary biologically active forms of secreted glucagon-like peptide-1 (GLP-1). GLP-1 is secreted as a pro-peptide that is then proteolytically cleaved into two active forms (7-37) and (7-36). These active peptides can promote insulin secretion in a glucose-dependent manner.

Product Properties

• Tag: 1196 1178
• CAS Number: [107444-51-9]