Pancreatic polypeptide bovine

Catalog Number: ECH-474-21-0.5MG
Article Name: Pancreatic polypeptide bovine
Biozol Catalog Number: ECH-474-21-0.5MG
Supplier Catalog Number: 474-21-0.5mg
Alternative Catalog Number: ECH-474-21-0.5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 4246.08Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Trp-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2Sequence (1-letter): APLEPEYPGDNATPEQMAQWAAELRRYINMLTRPRY-NH2Storage: -20 AC or belowPancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes water and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.
Tag: 1178