Molecular Weight: 4246.08Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Trp-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2Sequence (1-letter): APLEPEYPGDNATPEQMAQWAAELRRYINMLTRPRY-NH2Storage: -20 AC or belowPancreatic Polypeptide (PP) is an agonist at neuropeptide Y receptors. It is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas that affects the secretion of pancreatic enzymes water and electrolytes. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal.
Tag:
1178
* VAT and and shipping costs not included. Errors and price changes excepted
