Galanin rat, CAS [[114547-31-8]]

Catalog Number: ECH-475-25-1MG
Article Name: Galanin rat, CAS [[114547-31-8]]
Biozol Catalog Number: ECH-475-25-1MG
Supplier Catalog Number: 475-25-1mg
Alternative Catalog Number: ECH-475-25-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 114547-31-8Molecular Weight: 3162.6Salt Form: TFAPurity: >96%Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2Storage: -20 AC or belowGalanin is a non-selective agonist that binds the GAL1 GAL2 and GAL3 receptors and inhibits cAMP production. It has been shown to be an anticonvulsant in rats that prevents fully kindled seizures.
Tag: 1196 1178
CAS Number: [114547-31-8]